DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and Cpr64Ad

DIOPT Version :10

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:81 Identity:43/81 - (53%)
Similarity:51/81 - (62%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 APVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRI 141
            |||||..:      .|....||:|:|.|.|:||.|||.|.|.||||||.|:|.|::.|.||..||
  Fly   129 APVAAPIA------TEIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRI 187

  Fly   142 VEYTADSHNGFQATVK 157
            |.|.|||.|||.|.|:
  Fly   188 VSYYADSINGFNAVVQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 31/51 (61%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:459790 31/51 (61%)

Return to query results.
Submit another query.