DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and Pcp

DIOPT Version :10

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:61 Identity:18/61 - (29%)
Similarity:25/61 - (40%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHV 159
            ||.:.|   :|..| |....|...|..|:||.:....:|....|.|.||.. |:.....|:
  Fly    44 KYRYAY---ETSNG-ISASQEGLGGVAVQGGSSYTSPEGEVISVNYVADEF-GYHPVGAHI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 15/51 (29%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 15/51 (29%)

Return to query results.
Submit another query.