DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and CPR57

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_565363.1 Gene:CPR57 / 3290244 VectorBaseID:AGAP006831 Length:141 Species:Anopheles gambiae


Alignment Length:106 Identity:48/106 - (45%)
Similarity:62/106 - (58%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADS 148
            :.|:....|..:|.|:|||.|||||..|||.|.:||.||||:|:|.|.::|.||..|||||.||.
Mosquito    42 NQHRTRTRETLQHTPRYEFAYGVKDPITGDHKDRWEKRDGDRVQGVYMLEEPDGTQRIVEYEADG 106

  Fly   149 HNGFQATVKHVGHAS-----HLEHSHSYGQQYGHGHGHATS 184
            .:||:|.|.:|..|.     |...:|||...      |||:
Mosquito   107 VHGFRAIVTNVPLAKGTRTPHDTTAHSYNML------HATT 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 31/51 (61%)
CPR57XP_565363.1 Chitin_bind_4 58..110 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.