DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and Cpr65Av

DIOPT Version :10

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:66 Identity:20/66 - (30%)
Similarity:30/66 - (45%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 YEFNY----GVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVG 160
            |.|.|    ||...:..::|.....::...|:|..:....||:|..:.|.|| .||||....|:.
  Fly    46 YNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIAD-ENGFQPQGDHLP 109

  Fly   161 H 161
            |
  Fly   110 H 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 15/55 (27%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.