DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and Cpr5C

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster


Alignment Length:146 Identity:50/146 - (34%)
Similarity:66/146 - (45%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALLGVAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKAHSWGTVQDHHHQQ 75
            ||:..|:|..:|.|            |.:|.||             |....|.:...|.....| 
  Fly    10 ALIAAASAGVLPAG------------QLYHAAP-------------VATYAAPAPAAVLKTVAQ- 48

  Fly    76 WAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTR 140
              ||.|       ...||...||:|::.|.|:|..:||.|.|.|.||||.|:|.|::.::||..|
  Fly    49 --PVLA-------KADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKR 104

  Fly   141 IVEYTADSHNGFQATV 156
            .|:||||..|||.|.|
  Fly   105 TVQYTADPINGFNAVV 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 25/51 (49%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.