DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and LOC1281505

DIOPT Version :10

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_321427.2 Gene:LOC1281505 / 1281505 VectorBaseID:AGAMI1_008591 Length:213 Species:Anopheles gambiae


Alignment Length:65 Identity:35/65 - (53%)
Similarity:44/65 - (67%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATV 156
            ||...:|:|.|:||:.|..|||.|.|.|:|.||.|:|.|::.:.||..|.||||||.||||.|.|
Mosquito    59 EEYDANPQYSFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKRTVEYTADPHNGFNAVV 123

  Fly   157  156
            Mosquito   124  123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 28/51 (55%)
LOC1281505XP_321427.2 Chitin_bind_4 67..119 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.