DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and CPR72

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_316624.3 Gene:CPR72 / 1277180 VectorBaseID:AGAP006597 Length:138 Species:Anopheles gambiae


Alignment Length:183 Identity:71/183 - (38%)
Similarity:84/183 - (45%) Gaps:57/183 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LCCALLGVAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKAHSWGTVQDHH 72
            |..|.|.|||::.     |..|.|.||..:.||           .||.:..              
Mosquito     7 LTVACLAVAASAQ-----YWGEAGFGYGAEQHH-----------GHHDYYS-------------- 41

  Fly    73 HQQWAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADG 137
                                    ||.|:|.|||||..|||.|.|||.||||.|||.||:.||||
Mosquito    42 ------------------------HPSYKFEYGVKDPHTGDHKSQWEHRDGDVVKGAYTLHEADG 82

  Fly   138 RTRIVEYTADSHNGFQATVKHVGHASHLE---HSHSYGQQYGHGHGHATSYVD 187
            ..|:||||:|.|:||||.||.||||.|.:   |...|...||||.|::.|.:|
Mosquito    83 TERVVEYTSDKHHGFQAHVKRVGHAYHPQVYGHHGGYNGGYGHGSGYSYSKLD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 34/51 (67%)
CPR72XP_316624.3 Chitin_bind_4 45..97 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H123323
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D154170at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14822
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.