DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and CPR70

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_316348.4 Gene:CPR70 / 1276938 VectorBaseID:AGAP006283 Length:139 Species:Anopheles gambiae


Alignment Length:148 Identity:60/148 - (40%)
Similarity:68/148 - (45%) Gaps:47/148 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALLGVA-AASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA-HSWGTVQDHHH 73
            |||.|| :||.:.:|                         |.|.|..|..|.| |          
Mosquito     8 ALLAVAVSASPVEYG-------------------------HYAPHALVHAPVAVH---------- 37

  Fly    74 QQWAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGR 138
               |||..|..       .||..:|||.||||:||..|||||.|.|.||||.|||.|::.|.||.
Mosquito    38 ---APVLKHVV-------AEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGS 92

  Fly   139 TRIVEYTADSHNGFQATV 156
            .|.|:||||.||||.|.|
Mosquito    93 VRTVDYTADDHNGFNAVV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 33/51 (65%)
CPR70XP_316348.4 Chitin_bind_4 54..106 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.