DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cpr76Ba and CPR21

DIOPT Version :9

Sequence 1:	NP_649120.1	Gene:	Cpr76Ba / 40120	FlyBaseID:	FBgn0036878	Length:	204	Species:	Drosophila melanogaster
Sequence 2:	XP_316036.1	Gene:	CPR21 / 1276666	VectorBaseID:	AGAP005996	Length:	105	Species:	Anopheles gambiae

Alignment Length:	75	Identity:	27/75 - (36%)
Similarity:	33/75 - (44%)	Gaps:	15/75 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    99 KYE-FNYGVKDTK----TGDIKQQWETRD----GDK-----VKGGYTMKEADGRTRIVEYTADSH 149
            ||| .|.||...|    |.|..|:.|..:    ||.     |:|.|:....||:...|.|.|| .
Mosquito    29 KYENDNIGVDGYKFAFETSDGHQRQEQAELKKLGDDVEALVVRGSYSFTGDDGQVYTVNYVAD-E 92

  Fly   150 NGFQATVKHV 159
            ||||....|:
Mosquito    93 NGFQPEGAHL 102

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cpr76Ba	NP_649120.1	Chitin_bind_4	100..152	CDD:278791	22/65 (34%)
CPR21	XP_316036.1	Chitin_bind_4	40..95	CDD:278791	17/55 (31%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910