DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and LOC1272758

DIOPT Version :10

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_311664.4 Gene:LOC1272758 / 1272758 VectorBaseID:AGAMI1_001020 Length:128 Species:Anopheles gambiae


Alignment Length:60 Identity:33/60 - (55%)
Similarity:40/60 - (66%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATVK 157
            |:|.:.|.|:|..|||.|.|.||||||.|:|.|::.|.||..|.|.||||..|||.|.|:
Mosquito    40 PQYTYAYNVQDALTGDSKSQQETRDGDIVRGSYSLVEPDGTLRTVFYTADPVNGFNAVVQ 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 28/51 (55%)
LOC1272758XP_311664.4 Chitin_bind_4 42..94 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.