DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and CPR152

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_024667073.1 Gene:CPR152 / 1270916 VectorBaseID:AGAP012487 Length:317 Species:Anopheles gambiae


Alignment Length:181 Identity:64/181 - (35%)
Similarity:81/181 - (44%) Gaps:44/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SYIP--HGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVD-VPKAHSWGTVQD-----HHHQQ 75
            ||:|  ||   |.||   ....|||      |||      .| ||.:.|:||...     ||...
Mosquito    34 SYLPPAHG---HGHG---GDGGHHE------DHH------TDLVPPSSSYGTPDSSYGPPHHQSG 80

  Fly    76 WAPVAAHDSHHQWSHHEEPKHH----------PKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGY 130
            :.|  .||.|.  .||:...:|          .||||:|.|.:..|.......|.||||...|.|
Mosquito    81 FHP--DHDEHE--DHHDHHDNHDESGSFEDEPAKYEFSYEVDEEHTDLSFGHEEMRDGDYTTGKY 141

  Fly   131 TMKEADGRTRIVEYTADSHNGFQATVKHVG---HASHLEHSHSYGQQYGHG 178
            .:...|||.:||||.|| |.|::..:.:.|   |..|.||.|.:.|::|||
Mosquito   142 NVLLPDGRRQIVEYEAD-HKGYRPKITYEGGDEHPHHHEHPHEHAQEHGHG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 23/51 (45%)
CPR152XP_024667073.1 Chitin_bind_4 111..162 CDD:306811 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.