powered by:
Protein Alignment Cpr76Ba and CPR58
DIOPT Version :9
Sequence 1: | NP_649120.1 |
Gene: | Cpr76Ba / 40120 |
FlyBaseID: | FBgn0036878 |
Length: | 204 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_308913.3 |
Gene: | CPR58 / 1270233 |
VectorBaseID: | AGAP006830 |
Length: | 169 |
Species: | Anopheles gambiae |
Alignment Length: | 74 |
Identity: | 42/74 - (56%) |
Similarity: | 49/74 - (66%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 HPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGH 161
||||.|||||.|..|||:|.|.||||||.|||.|::.|.||..|.|:||||..|||.|. |..
Mosquito 33 HPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSVRTVDYTADPINGFNAV---VSK 94
Fly 162 ASHLEHSHS 170
.:.|.|:|:
Mosquito 95 TAPLVHAHA 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.