DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and CPR55

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_308909.2 Gene:CPR55 / 1270230 VectorBaseID:AGAP006837 Length:152 Species:Anopheles gambiae


Alignment Length:92 Identity:49/92 - (53%)
Similarity:54/92 - (58%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGH 161
            :|||:|.|||||..|||.|.|||.||||.|||.||:.|.||..|||||.||..|||:|.||.:|.
Mosquito    54 YPKYQFEYGVKDPLTGDHKSQWEMRDGDIVKGSYTLDEPDGTQRIVEYRADDRNGFEAIVKKIGK 118

  Fly   162 ASHLEH-------------SHSYGQQY 175
            ..|||.             .|..||.|
Mosquito   119 PKHLEELGKQLAVKQAADTHHIVGQSY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 34/51 (67%)
CPR55XP_308909.2 Chitin_bind_4 57..109 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H123323
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D154170at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.