DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9451 and Acp6

DIOPT Version :9

Sequence 1:NP_001262050.1 Gene:CG9451 / 40118 FlyBaseID:FBgn0036876 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_062774.2 Gene:Acp6 / 66659 MGIID:1931010 Length:418 Species:Mus musculus


Alignment Length:403 Identity:101/403 - (25%)
Similarity:169/403 - (41%) Gaps:99/403 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LKLVHVLFRHGPRTPVSTYPNDPYINETYEP----------FGW--------------------- 89
            ||:|.|:||||.|:|:...|.:..:.  :.|          |.:                     
Mouse    43 LKMVQVVFRHGARSPLKPLPLEEQVE--WNPKLLEIPPQTRFDYTVTNLAGGPKPHSHYDTEYRK 105

  Fly    90 ---------GALTNGAKVELYKIGKQLRQRYKD---FLPAYYQPDAIRAQSSESPRTLMSMQMVL 142
                     |.||.....:::.:|::||:.|.:   ||...|.|..:..:|:...|.|.|.:.:|
Mouse   106 TTLRGGVLAGQLTKVGMQQMFALGEKLRKNYVEDIPFLSPVYNPQEVFIRSTNMFRNLESTRCLL 170

  Fly   143 AGLFPPE------NTPMEWNQLL--NWQPIPIVMEPEETDVHIRMKAPCPRYDESVLEVIELPEV 199
            ||||..:      :|....:::|  |:|...::.|....    |.||           .|..|.:
Mouse   171 AGLFQHQKGSAVIHTDEASSEVLYPNYQSCWVLKEKTRG----RKKA-----------AISQPGI 220

  Fly   200 KKLHAESSDLLRELTTHTGLNITHAHDVTNVFITLLCEQTFGLQLPSWTNDYFPEKMLPLAEKS- 263
                  |.||.:   ..||:.|.:..||.  |..|| :.....|:.|..|....|:...|.|:. 
Mouse   221 ------SEDLEK---VKTGVGINNGDDVD--FFVLL-DNVAAEQVHSLLNCPALERFAQLIEQRA 273

  Fly   264 -----YVYDAYTTEQRKMKGGFFVELLLKQMQDRISGALKPA-NRKMFLSCGHDWTITNVLSALN 322
                 ||.:....|..:|..|.|:.:|...:...:.....|: .|||:|...||.|:..:|.||.
Mouse   274 VDMALYVVEQEDRESIQMAVGPFLHILEGNLLKTVDPTTAPSKTRKMYLYATHDVTLLPMLLALG 338

  Fly   323 VWEAQMPRFSSLIAFELHQNPQTGEYFLEIYFQNDPHKEPQQLQIP-GC-EKQCPIGKLLELTKD 385
            :::.:.|.|:..:..||:|:.::.|:|:::::..   ||    |:| || :|.||:.|.|. |..
Mouse   339 IFDQKWPPFAVDLTMELYQHQESKEWFVQLFYNG---KE----QVPRGCPDKLCPLDKFLN-TMS 395

  Fly   386 IIPDAP--YAELC 396
            :...:|  |..||
Mouse   396 VYSVSPEKYRTLC 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9451NP_001262050.1 HP_HAP_like 55..355 CDD:132717 85/356 (24%)
Acp6NP_062774.2 HP_HAP_like 42..371 CDD:132717 85/356 (24%)
Substrate binding. /evidence=ECO:0000250 51..161 20/111 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7717
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100295
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.600

Return to query results.
Submit another query.