DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9451 and ACP2

DIOPT Version :9

Sequence 1:NP_001262050.1 Gene:CG9451 / 40118 FlyBaseID:FBgn0036876 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001343945.1 Gene:ACP2 / 53 HGNCID:123 Length:434 Species:Homo sapiens


Alignment Length:338 Identity:115/338 - (34%)
Similarity:188/338 - (55%) Gaps:10/338 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TLKLVHVLFRHGPRTPVSTYPNDPYINETYEPFGWGALTNGAKVELYKIGKQLRQRYKDFLPAYY 119
            :|:.|.:|:|||.|:||.|||.|||..|.: |.|:|.||....::.:::|:.|||||..||...|
Human    32 SLRFVTLLYRHGDRSPVKTYPKDPYQEEEW-PQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSY 95

  Fly   120 QPDAIRAQSSESPRTLMSMQMVLAGLFPPENTPMEWNQLLNWQPIPIVMEPEETDVHIRMK-APC 183
            ....:..:|::..|||||.:..||||||| |....:|..::|||||:...|...|..::.. .||
Human    96 HRQEVYVRSTDFDRTLMSAEANLAGLFPP-NGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPC 159

  Fly   184 PRYDESVLEVIELPEVKKLHAESSDLLRELTTHTGLNITHAHDVTNVFITLLCEQTFGLQLPSWT 248
            |||::...|..:.||.:...:.::..|..:...|||.......|.||:.||.||||.||:||.|.
Human   160 PRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWA 224

  Fly   249 NDYFPEKMLPLAEKS--YVYDAY-TTEQRKMKGGFFVELLLKQMQDRISGALKPANRKMFLSCGH 310
            :....:::..|.:.|  :::..| ..|:.:::||..:..:.|.:....:.:..|   |:.:...|
Human   225 SPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLP---KLLVYSAH 286

  Fly   311 DWTITNVLSALNVWEAQMPRFSSLIAFELHQNPQTGEYFLEIYFQNDPHKEPQQLQIPGCEKQCP 375
            |.|:..:..||:|:..:...::|...|||:|. .:|.:.:|:||:|:..|.|..|.:|||..:||
Human   287 DTTLVALQMALDVYNGEQAPYASCHIFELYQE-DSGNFSVEMYFRNESDKAPWPLSLPGCPHRCP 350

  Fly   376 IGKLLELTKDIIP 388
            :...|.||:.::|
Human   351 LQDFLRLTEPVVP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9451NP_001262050.1 HP_HAP_like 55..355 CDD:132717 101/303 (33%)
ACP2NP_001343945.1 HP_HAP_like 33..330 CDD:132717 101/302 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100295
Panther 1 1.100 - - O PTHR11567
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.