DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9451 and ACP6

DIOPT Version :9

Sequence 1:NP_001262050.1 Gene:CG9451 / 40118 FlyBaseID:FBgn0036876 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_057445.4 Gene:ACP6 / 51205 HGNCID:29609 Length:428 Species:Homo sapiens


Alignment Length:424 Identity:95/424 - (22%)
Similarity:167/424 - (39%) Gaps:108/424 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AEISHAKDS--VSNSTLKL--VHVLFRHGPRTPVSTYPNDPYIN--------------------- 81
            ||:..|...  |..|.|||  |.|:||||.|:|:...|.:..:.                     
Human    32 AELQEADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPPQTQFDYTVTNL 96

  Fly    82 ----ETYEPFG-------------WGALTNGAKVELYKIGKQLRQRYKD---FLPAYYQPDAIRA 126
                :.|.|:.             .|.||.....:::.:|::||:.|.:   ||...:.|..:..
Human    97 AGGPKPYSPYDSQYHETTLKGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEVFI 161

  Fly   127 QSSESPRTLMSMQMVLAGLFPPENTPMEWNQLLNWQPIPIVMEPEETDVHIRMKAPCPRYDESVL 191
            :|:...|.|.|.:.:|||||..:...            ||::..:|.|..:..    |.| :|..
Human   162 RSTNIFRNLESTRCLLAGLFQCQKEG------------PIIIHTDEADSEVLY----PNY-QSCW 209

  Fly   192 EVIELP----EVKKLHAESSDLLRELTTHTGLNITHAHDVTNVFITL---LCEQTFGLQLPSWTN 249
            .:.:..    :...|....|:.|:::....|::   :.|..:.||.|   ..||..  .|||   
Human   210 SLRQRTRGRRQTASLQPGISEDLKKVKDRMGID---SSDKVDFFILLDNVAAEQAH--NLPS--- 266

  Fly   250 DYFPEKMLPLAEK-------------SYVYDAYTTEQRKMKGGFFVELLLKQMQDRISGALKPAN 301
                   .|:.::             .|:......|..:|..|.|:.:|...:...:..|..|..
Human   267 -------CPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAVGPFLHILESNLLKAMDSATAPDK 324

  Fly   302 -RKMFLSCGHDWTITNVLSALNVWEAQMPRFSSLIAFELHQNPQTGEYFLEIYFQNDPHKEPQQL 365
             ||::|...||.|...:|..|.:::.:.|.|:..:..||:|:.::.|:|:::|:..   ||    
Human   325 IRKLYLYAAHDVTFIPLLMTLGIFDHKWPPFAVDLTMELYQHLESKEWFVQLYYHG---KE---- 382

  Fly   366 QIP-GC-EKQCPIGKLLE-LTKDIIPDAPYAELC 396
            |:| || :..||:...|. ::...:....|..||
Human   383 QVPRGCPDGLCPLDMFLNAMSVYTLSPEKYHALC 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9451NP_001262050.1 HP_HAP_like 55..355 CDD:132717 78/363 (21%)
ACP6NP_057445.4 HP_HAP_like 49..379 CDD:132717 77/361 (21%)
Substrate binding. /evidence=ECO:0000250 58..168 19/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155672
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7717
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100295
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.600

Return to query results.
Submit another query.