DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9451 and Acp6

DIOPT Version :9

Sequence 1:NP_001262050.1 Gene:CG9451 / 40118 FlyBaseID:FBgn0036876 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001026815.1 Gene:Acp6 / 295305 RGDID:1306336 Length:413 Species:Rattus norvegicus


Alignment Length:413 Identity:91/413 - (22%)
Similarity:155/413 - (37%) Gaps:119/413 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LKLVHVLFRHGPRTPVSTYPNDPYINETYEPFGW------------------------------- 89
            ||:|.|:||||.|:|:...|.:..:.       |                               
  Rat    38 LKMVQVVFRHGARSPLKPLPLEDQVE-------WNPKLLEIPPQTRFEYTVANLAGGPKPHSHYD 95

  Fly    90 --------------GALTNGAKVELYKIGKQLRQRYKD---FLPAYYQPDAIRAQSSESPRTLMS 137
                          |.||.....:::.:|::||:.|.:   ||...|.|..:..:|:...|.|.|
  Rat    96 TEYHRTVLRGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPIYNPQEVFVRSTNMFRNLES 160

  Fly   138 MQMVLAGLFPPENTPMEWNQLLNWQPIPIVMEPEETDVHIRMKAPCPRYDESVLEVI-------- 194
            .:.:|||||.                    .:.|...:|.         ||::.||:        
  Rat   161 TRCLLAGLFQ--------------------RQKESVIIHT---------DEAISEVLYPNYQSCW 196

  Fly   195 ELPEV----KKLHAESSDLLREL-TTHTGLNITHAHDVTNVFITLLCEQTFGLQLPSWTNDYFPE 254
            .|.|.    ||.......:|.:| ....|:.|.   |..||...:|.:.....:..|..:....:
  Rat   197 SLREKTRGRKKAAISQPGILEDLEKVKAGVGIA---DSDNVDFFILLDNMVAEEAHSLLSSPALK 258

  Fly   255 KMLPLAEKS------YVYDAYTTEQRKMKGGFFVELLLKQMQDRISGALKPA-NRKMFLSCGHDW 312
            :...|.|:.      |:......|..:|..|.|:.:|...:...:..:..|: .|||:|...||.
  Rat   259 RFAQLIEQRAVDMALYMLQQEDRESIQMAVGPFLYILEGNLLKAVDPSTPPSKTRKMYLYATHDV 323

  Fly   313 TITNVLSALNVWEAQMPRFSSLIAFELHQNPQTGEYFLEIYFQNDPHKEPQQLQIP-GC-EKQCP 375
            |:..:|.||.:::.:.|.|:..:..||:|:.::.|:|:.:.:..       |.|:| || :|.||
  Rat   324 TLLPMLLALGIFDNKWPPFAVDLTVELYQHQESKEWFVRLSYNG-------QEQVPRGCPDKLCP 381

  Fly   376 IGKLLELTK--DIIPDAPYAELC 396
            :.|.|....  .:.|: .|..||
  Rat   382 LDKFLNTMSAYSVSPE-KYRRLC 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9451NP_001262050.1 HP_HAP_like 55..355 CDD:132717 77/366 (21%)
Acp6NP_001026815.1 HP_HAP_like 37..366 CDD:132717 77/366 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349577
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100295
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.