DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9451 and Acp2

DIOPT Version :9

Sequence 1:NP_001262050.1 Gene:CG9451 / 40118 FlyBaseID:FBgn0036876 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006234562.1 Gene:Acp2 / 24162 RGDID:2021 Length:459 Species:Rattus norvegicus


Alignment Length:341 Identity:118/341 - (34%)
Similarity:190/341 - (55%) Gaps:16/341 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TLKLVHVLFRHGPRTPVSTYPNDPYINETYEPFGWGALTNGAKVELYKIGKQLRQRYKDFLPAYY 119
            :|:.|.:|:|||.|:||..||.|||..|.: |.|:|.||....::.:::|:.|||||..||.|.|
  Rat    68 SLRFVTLLYRHGDRSPVKAYPKDPYQEEKW-PQGFGQLTKEGMLQHWELGQALRQRYHGFLNASY 131

  Fly   120 QPDAIRAQSSESPRTLMSMQMVLAGLFPPENTPMEWNQLLNWQPIPIVMEPEETDVHIRMK-APC 183
            ....:..:|::..|||||.:..|||||||... ..:|..::|||||:...|...|..::.. .||
  Rat   132 HRQEVYVRSTDFDRTLMSAEANLAGLFPPTEV-QHFNPNISWQPIPVHTVPITEDRLLKFPLGPC 195

  Fly   184 PRYDESVLEVIELPEVKKLHAESSDLLRELTTHTGL-NITHAHDVTNVFITLLCEQTFGLQLPSW 247
            |||::...|..:.||.:.:..:::..|..:...||| |:| ...:.||:.||.||||.||.||.|
  Rat   196 PRYEQLQNETRQTPEYQNMSIQNAQFLDMVANETGLMNLT-LETIWNVYDTLFCEQTHGLLLPPW 259

  Fly   248 TNDYFPEKMLPLAEKSY-----VYDAYTTEQRKMKGGFFVELLLKQMQDRISGALKPANRKMFLS 307
            .:....:::..|.:.|:     ::|  ..::.:::||..:..:||.:....:.:..|   |:.:.
  Rat   260 ASPQTVQRLSQLKDFSFLFLFGIHD--QVQKARLQGGVLLAQILKNLTLMATTSQFP---KLLVY 319

  Fly   308 CGHDWTITNVLSALNVWEAQMPRFSSLIAFELHQNPQTGEYFLEIYFQNDPHKEPQQLQIPGCEK 372
            ..||.|:..:..||||:..:...::|...|||:|. ..|.:.:|:||:||..|.|..|.:|||..
  Rat   320 SAHDTTLVALQMALNVYNGKQAPYASCHIFELYQE-DNGNFSVEMYFRNDSKKAPWPLTLPGCPH 383

  Fly   373 QCPIGKLLELTKDIIP 388
            :||:...|.||:.:||
  Rat   384 RCPLQDFLRLTEPVIP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9451NP_001262050.1 HP_HAP_like 55..355 CDD:132717 102/306 (33%)
Acp2XP_006234562.1 HP_HAP_like 69..366 CDD:132717 102/305 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349571
Domainoid 1 1.000 156 1.000 Domainoid score I4084
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100295
Panther 1 1.100 - - O PTHR11567
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.