DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9451 and acp-2

DIOPT Version :9

Sequence 1:NP_001262050.1 Gene:CG9451 / 40118 FlyBaseID:FBgn0036876 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_495774.1 Gene:acp-2 / 174343 WormBaseID:WBGene00008802 Length:408 Species:Caenorhabditis elegans


Alignment Length:394 Identity:83/394 - (21%)
Similarity:154/394 - (39%) Gaps:100/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VLFRHGPRTPVSTYPNDPYINETYEPFGWGALTNGAKVELYKIGKQLRQRYKD--FLPAYYQPDA 123
            ||||||.|.|.::..:..|:...  |.|.|.||:......:::|:.|:.||.|  |:....:|..
 Worm    30 VLFRHGARAPSNSLSDPAYLANF--PRGLGELTDRGFENSFRLGRFLKTRYVDSKFVDGNLKPRQ 92

  Fly   124 IRAQSSESPRTLMSMQMVLAGLFP--------PENTPMEWNQLLNWQPIPIVMEPEETDVHIRMK 180
            :..:|....|.|.|...|.|.:|.        |..|......|||:.....   |.|.::   :|
 Worm    93 MYWRSVNKNRCLSSASTVGAAMFEDPSRHLYVPVLTEEIGENLLNYDQANC---PRELEL---IK 151

  Fly   181 APCPR----------YDESVLEVIELPEVKKLHAESSDLLRELTTHT----------GLNI---- 221
            ..||.          |:|.:...:     |..|    .:.::...||          |:.:    
 Worm   152 EKCPDFGGSFHPWTIYEEFIANCL-----KYTH----PVFKQYPFHTIEAHINEYKNGIPLPPLI 207

  Fly   222 -THAHDVTNVFITLLCEQTFGLQLPSWTNDYFPEKMLPLAEKSYVYDAYTTEQRKMKGGFFVELL 285
             .|.:::..:::.:       .|..:.|.::...:|:                 |:|.|..:..|
 Worm   208 AQHINEIMGIYVNV-------TQFITGTGNHHDPRMM-----------------KVKFGNLMNTL 248

  Fly   286 LKQMQDRI---------SGALKPANRKMFLSCGHDWTITNVLSALNVWEA-----QMPRFSSLIA 336
            |..::::|         |........|:.:....||.:..||.:|||.|.     :.|.::|:|.
 Worm   249 LTDIKNKIYMDKEEKHKSDGRVSRREKLAVYSTQDWILMGVLDSLNVLEQTVGLDKYPEYNSMII 313

  Fly   337 FELHQNPQTGEYFLEIYFQNDP-HKEPQQL-----QIPGCEKQ-CPIGKLLELTKDIIPDAPYAE 394
            ||..::  .|:||::::::.:. ..|..:|     .:..|::: |.....|:...| ..:...||
 Worm   314 FETWKD--NGKYFVKVFYKKEEITAEDHELIDVTKFVRNCKRERCLAQDFLDCCDD-YRNKGEAE 375

  Fly   395 LCKA 398
            .|:|
 Worm   376 SCEA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9451NP_001262050.1 HP_HAP_like 55..355 CDD:132717 73/342 (21%)
acp-2NP_495774.1 HP_HAP_like 29..329 CDD:132717 73/341 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164144
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4294
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.