DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9451 and Acp2

DIOPT Version :9

Sequence 1:NP_001262050.1 Gene:CG9451 / 40118 FlyBaseID:FBgn0036876 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001343996.1 Gene:Acp2 / 11432 MGIID:87882 Length:434 Species:Mus musculus


Alignment Length:338 Identity:118/338 - (34%)
Similarity:186/338 - (55%) Gaps:10/338 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TLKLVHVLFRHGPRTPVSTYPNDPYINETYEPFGWGALTNGAKVELYKIGKQLRQRYKDFLPAYY 119
            :|:.|.:|:|||.|:||.|||.|||..|.: |.|:|.||....::.:::|:.|||||..||...|
Mouse    32 SLRFVTLLYRHGDRSPVKTYPKDPYQEEKW-PQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSY 95

  Fly   120 QPDAIRAQSSESPRTLMSMQMVLAGLFPPENTPMEWNQLLNWQPIPIVMEPEETDVHIRMK-APC 183
            ....:..:|::..|||||.:..||||||| |....:|..::|||||:...|...|..::.. .||
Mouse    96 HRQEVYVRSTDFDRTLMSAEANLAGLFPP-NEVQHFNPNISWQPIPVHTVPITEDRLLKFPLGPC 159

  Fly   184 PRYDESVLEVIELPEVKKLHAESSDLLRELTTHTGLNITHAHDVTNVFITLLCEQTFGLQLPSWT 248
            |||::...|..:.||.:....:::..|..:...|||.......:.||:.||.||||.||.||.|.
Mouse   160 PRYEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTLFCEQTHGLLLPPWA 224

  Fly   249 NDYFPEKMLPLAEKSYVYDAYTTEQ---RKMKGGFFVELLLKQMQDRISGALKPANRKMFLSCGH 310
            :....:::..|.:.|:::.....||   .:::||..:..:||.:....:.:..|   |:.:...|
Mouse   225 SPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGGVLLAQILKNLTLMATTSQFP---KLLVYSAH 286

  Fly   311 DWTITNVLSALNVWEAQMPRFSSLIAFELHQNPQTGEYFLEIYFQNDPHKEPQQLQIPGCEKQCP 375
            |.|:..:..||||:..:...::|...|||:|. ..|.:.:|:||:||..|.|..|.:|||..:||
Mouse   287 DTTLVALQMALNVYNGKQAPYASCHIFELYQE-DNGNFSVEMYFRNDSKKAPWPLILPGCPHRCP 350

  Fly   376 IGKLLELTKDIIP 388
            :...|.||:.:||
Mouse   351 LQDFLRLTEPVIP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9451NP_001262050.1 HP_HAP_like 55..355 CDD:132717 102/303 (34%)
Acp2NP_001343996.1 HP_HAP_like 33..330 CDD:132717 102/302 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846107
Domainoid 1 1.000 42 1.000 Domainoid score I12372
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100295
Panther 1 1.100 - - O PTHR11567
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.