DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9449 and acp6

DIOPT Version :9

Sequence 1:NP_001137976.1 Gene:CG9449 / 40117 FlyBaseID:FBgn0036875 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001103850.1 Gene:acp6 / 558758 ZFINID:ZDB-GENE-050208-290 Length:405 Species:Danio rerio


Alignment Length:448 Identity:105/448 - (23%)
Similarity:192/448 - (42%) Gaps:125/448 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GLIASAVIIWCVAHSTVESTAKLYDPGADKSTLELLHVVFRHGPRTPADTY-------------- 67
            |.:|...:.|...:.|   .|..|:       |:|:.|:||||.|||..:.              
Zfish     9 GSVALGSVFWFQKNKT---EASPYE-------LKLIQVLFRHGARTPLKSIPDVLEAQWSPELLE 63

  Fly    68 -----------------PRDPY-VNETY---------YPFGWGQITNNGKRELFNIGTWLRKRY- 104
                             ||.|. |.::|         ||   ||:|..|.::|:::|..|||:| 
Zfish    64 APAHTKIDYMVTDLEGGPRPPAPVEDSYRAKILTGGTYP---GQLTTIGMQQLYDLGVRLRKKYI 125

  Fly   105 --GKFLAPNYSPDSVHAQATGVPRTHMTMQTVLAAFFPPKGTDMEWNSRFNWQPIPVFSQELNED 167
              ..||.|.::|..|:.::|.:.||..:.:.::|..|..:...:          :.:.:.:..::
Zfish   126 QEEPFLTPTFNPKEVYIRSTNIVRTIESAKCLVAGLFQQEQAGV----------VSILTDKAEKE 180

  Fly   168 TLLLVRKPCPRYF----------EALNEVYELPEVKAEIEPYLEMFKELEEHTGLSFKEPEDVQS 222
            .|.      |.|.          ....|...||::.|:::       .:::..|:..::..|...
Zfish   181 VLY------PNYHGCKLLKMLIGNRWAESSTLPDIAADLQ-------NIQDDLGVDAQQRLDFIL 232

  Fly   223 LYLTLLAEQEWGLELP----EWTHAYFPEKLQFLAEQ---SYIYNVYTPEMQ---KIKGGPFLKK 277
            :...::|.:..||.||    :|         :...||   ..||::|.|..:   ::..||.|..
Zfish   233 IRDDMVARETHGLPLPTVLEQW---------RSTIEQRAVDMIYHIYEPSKRQNLQMCVGPLLNM 288

  Fly   278 MLDEMQQKKNGTLKPSGRKLFIYAGHDSTVVNVLSALKIWERQMPRYSSMILFELHKNKETGDYW 342
            ::..|:.|...:.....||||:|:.||:|::..|.||.:::.:.|.|::.|..||:::::|..::
Zfish   289 LVTNMEDKIQSSPSKQDRKLFLYSVHDTTLMPCLMALGVFDMKWPPYAADITLELYQHRQTNQHY 353

  Fly   343 VEI-YFRNDPKGQAQKLTLPGC-EFQCPLDKVLEF-AKDVVPTEADDK---RCESRNE 394
            |:: |...|.|       :||| ...||:|   || |...|.:..||:   .|||.::
Zfish   354 VKVSYIDQDQK-------IPGCSNIYCPID---EFKAAMAVHSLPDDRYYALCESADD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9449NP_001137976.1 HP_HAP_like 48..348 CDD:132717 82/364 (23%)
acp6NP_001103850.1 HP_HAP_like 30..358 CDD:132717 81/369 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590853
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.