DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9449 and ACP2

DIOPT Version :9

Sequence 1:NP_001137976.1 Gene:CG9449 / 40117 FlyBaseID:FBgn0036875 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001343945.1 Gene:ACP2 / 53 HGNCID:123 Length:434 Species:Homo sapiens


Alignment Length:349 Identity:121/349 - (34%)
Similarity:188/349 - (53%) Gaps:16/349 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PGADKSTLELLHVVFRHGPRTPADTYPRDPYVNETYYPFGWGQITNNGKRELFNIGTWLRKRYGK 106
            |.....:|..:.:::|||.|:|..|||:||| .|..:|.|:||:|..|..:.:.:|..||:||..
Human    26 PPTRARSLRFVTLLYRHGDRSPVKTYPKDPY-QEEEWPQGFGQLTKEGMLQHWELGQALRQRYHG 89

  Fly   107 FLAPNYSPDSVHAQATGVPRTHMTMQTVLAAFFPPKGTDMEWNSRFNWQPIPVFSQELNEDTLL- 170
            ||..:|....|:.::|...||.|:.:..||..|||.|. ..:|...:||||||.:..:.||.|| 
Human    90 FLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGM-QRFNPNISWQPIPVHTVPITEDRLLK 153

  Fly   171 LVRKPCPRYFEALNEVYELPEVKAEIEPYLEMFKELEEHTGLSFKEPEDVQSLYLTLLAEQEWGL 235
            ....|||||.:..||..:.||.:.|.....:....:...|||:....|.|.::|.||..||..||
Human   154 FPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGL 218

  Fly   236 ELPEWTHAYFPEKLQFLAEQS--YIYNVY-TPEMQKIKGGPFLKKMLDEMQQKKNGTLKPSGR-- 295
            .||.|......::|..|.:.|  :::.:| ..|..:::||..|      .|.:||.||..:..  
Human   219 RLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLL------AQIRKNLTLMATTSQL 277

  Fly   296 -KLFIYAGHDSTVVNVLSALKIWERQMPRYSSMILFELHKNKETGDYWVEIYFRNDPKGQAQKLT 359
             ||.:|:.||:|:|.:..||.::..:...|:|..:|||:: :::|::.||:||||:.......|:
Human   278 PKLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQ-EDSGNFSVEMYFRNESDKAPWPLS 341

  Fly   360 LPGCEFQCPLDKVLEFAKDVVPTE 383
            ||||..:|||...|...:.|||.:
Human   342 LPGCPHRCPLQDFLRLTEPVVPKD 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9449NP_001137976.1 HP_HAP_like 48..348 CDD:132717 105/306 (34%)
ACP2NP_001343945.1 HP_HAP_like 33..330 CDD:132717 105/305 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155664
Domainoid 1 1.000 163 1.000 Domainoid score I3961
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8533
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11567
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.