DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9449 and CG9451

DIOPT Version :9

Sequence 1:NP_001137976.1 Gene:CG9449 / 40117 FlyBaseID:FBgn0036875 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001262050.1 Gene:CG9451 / 40118 FlyBaseID:FBgn0036876 Length:410 Species:Drosophila melanogaster


Alignment Length:366 Identity:189/366 - (51%)
Similarity:258/366 - (70%) Gaps:4/366 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VAHSTVE-STAKLYDPGADKSTLELLHVVFRHGPRTPADTYPRDPYVNETYYPFGWGQITNNGKR 91
            |:.|:.| |.||   .....|||:|:||:||||||||..|||.|||:||||.|||||.:||..|.
  Fly    37 VSQSSAEISHAK---DSVSNSTLKLVHVLFRHGPRTPVSTYPNDPYINETYEPFGWGALTNGAKV 98

  Fly    92 ELFNIGTWLRKRYGKFLAPNYSPDSVHAQATGVPRTHMTMQTVLAAFFPPKGTDMEWNSRFNWQP 156
            ||:.||..||:||..||...|.||::.||::..|||.|:||.|||..|||:.|.||||...||||
  Fly    99 ELYKIGKQLRQRYKDFLPAYYQPDAIRAQSSESPRTLMSMQMVLAGLFPPENTPMEWNQLLNWQP 163

  Fly   157 IPVFSQELNEDTLLLVRKPCPRYFEALNEVYELPEVKAEIEPYLEMFKELEEHTGLSFKEPEDVQ 221
            ||:..:....|..:.::.|||||.|::.||.||||||.......::.:||..||||:.....||.
  Fly   164 IPIVMEPEETDVHIRMKAPCPRYDESVLEVIELPEVKKLHAESSDLLRELTTHTGLNITHAHDVT 228

  Fly   222 SLYLTLLAEQEWGLELPEWTHAYFPEKLQFLAEQSYIYNVYTPEMQKIKGGPFLKKMLDEMQQKK 286
            ::::|||.||.:||:||.||:.|||||:..|||:||:|:.||.|.:|:|||.|::.:|.:||.:.
  Fly   229 NVFITLLCEQTFGLQLPSWTNDYFPEKMLPLAEKSYVYDAYTTEQRKMKGGFFVELLLKQMQDRI 293

  Fly   287 NGTLKPSGRKLFIYAGHDSTVVNVLSALKIWERQMPRYSSMILFELHKNKETGDYWVEIYFRNDP 351
            :|.|||:.||:|:..|||.|:.||||||.:||.||||:||:|.||||:|.:||:|::||||:|||
  Fly   294 SGALKPANRKMFLSCGHDWTITNVLSALNVWEAQMPRFSSLIAFELHQNPQTGEYFLEIYFQNDP 358

  Fly   352 KGQAQKLTLPGCEFQCPLDKVLEFAKDVVPTEADDKRCESR 392
            ..:.|:|.:||||.|||:.|:||..||::|.....:.|:::
  Fly   359 HKEPQQLQIPGCEKQCPIGKLLELTKDIIPDAPYAELCKAK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9449NP_001137976.1 HP_HAP_like 48..348 CDD:132717 162/299 (54%)
CG9451NP_001262050.1 HP_HAP_like 55..355 CDD:132717 162/299 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443469
Domainoid 1 1.000 42 1.000 Domainoid score I12372
eggNOG 1 0.900 - - E1_KOG3720
Homologene 1 1.000 - - H116078
Inparanoid 1 1.050 359 1.000 Inparanoid score I4403
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 1 1.000 - - FOG0014252
OrthoInspector 1 1.000 - - otm14614
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11567
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4294
1110.900

Return to query results.
Submit another query.