powered by:
Protein Alignment CG9449 and CG16890
DIOPT Version :9
Sequence 1: | NP_001137976.1 |
Gene: | CG9449 / 40117 |
FlyBaseID: | FBgn0036875 |
Length: | 404 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_609671.1 |
Gene: | CG16890 / 34781 |
FlyBaseID: | FBgn0028932 |
Length: | 258 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 16/53 - (30%) |
Similarity: | 25/53 - (47%) |
Gaps: | 9/53 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 149 NSRFNWQPIPVFSQELNEDTLLLVRKPCPRYFEALNEVYELPEVKAEIEPYLE 201
|.||.|: ..||:.|||...::...||:..|.:.|.: |::..|.|
Fly 50 NHRFLWE-----DDELDSDTLSWEQRLALRYYRKLFKEYCI----ADLSRYKE 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45462393 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11567 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.