DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9449 and Acp2

DIOPT Version :9

Sequence 1:NP_001137976.1 Gene:CG9449 / 40117 FlyBaseID:FBgn0036875 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_006234562.1 Gene:Acp2 / 24162 RGDID:2021 Length:459 Species:Rattus norvegicus


Alignment Length:370 Identity:127/370 - (34%)
Similarity:203/370 - (54%) Gaps:28/370 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PGADKSTLELLHVVFRHGPRTPADTYPRDPYVNETYYPFGWGQITNNGKRELFNIGTWLRKRYGK 106
            |.....:|..:.:::|||.|:|...||:||| .|..:|.|:||:|..|..:.:.:|..||:||..
  Rat    62 PPIQARSLRFVTLLYRHGDRSPVKAYPKDPY-QEEKWPQGFGQLTKEGMLQHWELGQALRQRYHG 125

  Fly   107 FLAPNYSPDSVHAQATGVPRTHMTMQTVLAAFFPPKGTDME-WNSRFNWQPIPVFSQELNEDTLL 170
            ||..:|....|:.::|...||.|:.:..||..|||  |::: :|...:||||||.:..:.||.||
  Rat   126 FLNASYHRQEVYVRSTDFDRTLMSAEANLAGLFPP--TEVQHFNPNISWQPIPVHTVPITEDRLL 188

  Fly   171 -LVRKPCPRYFEALNEVYELPE---VKAEIEPYLEMFKELEEHTGLSFKEPEDVQSLYLTLLAEQ 231
             ....|||||.:..||..:.||   :..:...:|:|   :...|||.....|.:.::|.||..||
  Rat   189 KFPLGPCPRYEQLQNETRQTPEYQNMSIQNAQFLDM---VANETGLMNLTLETIWNVYDTLFCEQ 250

  Fly   232 EWGLELPEWTHAYFPEKLQFLAEQS--YIYNVYTPEMQK--IKGGPFLKKMLDEMQQKKNGTLKP 292
            ..||.||.|......::|..|.:.|  :::.:: .::||  ::||..|.::|      ||.||..
  Rat   251 THGLLLPPWASPQTVQRLSQLKDFSFLFLFGIH-DQVQKARLQGGVLLAQIL------KNLTLMA 308

  Fly   293 SGR---KLFIYAGHDSTVVNVLSALKIWERQMPRYSSMILFELHKNKETGDYWVEIYFRNDPKGQ 354
            :..   ||.:|:.||:|:|.:..||.::..:...|:|..:|||:: ::.|::.||:|||||.|..
  Rat   309 TTSQFPKLLVYSAHDTTLVALQMALNVYNGKQAPYASCHIFELYQ-EDNGNFSVEMYFRNDSKKA 372

  Fly   355 AQKLTLPGCEFQCPLDKVLEFAKDVVPTEADDKRCE-SRNEAFTE 398
            ...||||||..:|||...|...:.|:|.:. .|.|: :.:.|.||
  Rat   373 PWPLTLPGCPHRCPLQDFLRLTEPVIPKDW-QKECQLASDTADTE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9449NP_001137976.1 HP_HAP_like 48..348 CDD:132717 104/311 (33%)
Acp2XP_006234562.1 HP_HAP_like 69..366 CDD:132717 104/310 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349569
Domainoid 1 1.000 156 1.000 Domainoid score I4084
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9008
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11567
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.