DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9449 and acp-2

DIOPT Version :9

Sequence 1:NP_001137976.1 Gene:CG9449 / 40117 FlyBaseID:FBgn0036875 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_495774.1 Gene:acp-2 / 174343 WormBaseID:WBGene00008802 Length:408 Species:Caenorhabditis elegans


Alignment Length:363 Identity:94/363 - (25%)
Similarity:165/363 - (45%) Gaps:67/363 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LIASAVIIWCVAHSTVESTAKLYDPGADKSTLELLHVVFRHGPRTPADTYPRDPYVNETYYPFGW 82
            |....::.:.:|.|  |:..::|           ..|:||||.|.|:::.....|:  ..:|.|.
 Worm     7 LFICLIVQFAIALS--ENPKRIY-----------TQVLFRHGARAPSNSLSDPAYL--ANFPRGL 56

  Fly    83 GQITNNGKRELFNIGTWLRKRY--GKFLAPNYSPDSVHAQATGVPRTHMTMQTVLAAFFPPKGTD 145
            |::|:.|....|.:|.:|:.||  .||:..|..|..::.::....|...:..||.||.|      
 Worm    57 GELTDRGFENSFRLGRFLKTRYVDSKFVDGNLKPRQMYWRSVNKNRCLSSASTVGAAMF------ 115

  Fly   146 MEWNSRFNWQPIPVFSQELNEDTLLLVRKPCPRYFEALNEVYELPEVKAEIEPYLEMFKELEEHT 210
             |..||..:  :||.::|:.|:.|...:..|||..|.:.|  :.|:......|: .:::|...:.
 Worm   116 -EDPSRHLY--VPVLTEEIGENLLNYDQANCPRELELIKE--KCPDFGGSFHPW-TIYEEFIANC 174

  Fly   211 GLSFKEPEDVQSLYLTLLA---EQEWGLELPEWTHAYFPEKLQFLAEQSYIY-----------NV 261
             |.:..|...|..:.|:.|   |.:.|:.||       |...|.:.|...||           |.
 Worm   175 -LKYTHPVFKQYPFHTIEAHINEYKNGIPLP-------PLIAQHINEIMGIYVNVTQFITGTGNH 231

  Fly   262 YTPEMQKIKGGPFLKKMLDEMQQK----KNGTLKPSGR-----KLFIYAGHDSTVVNVLSALKIW 317
            :.|.|.|:|.|..:..:|.:::.|    |....|..||     ||.:|:..|..::.||.:|.:.
 Worm   232 HDPRMMKVKFGNLMNTLLTDIKNKIYMDKEEKHKSDGRVSRREKLAVYSTQDWILMGVLDSLNVL 296

  Fly   318 ER-----QMPRYSSMILFELHKNKETGDYWVEIYFRND 350
            |:     :.|.|:|||:||..  |:.|.|:|:::::.:
 Worm   297 EQTVGLDKYPEYNSMIIFETW--KDNGKYFVKVFYKKE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9449NP_001137976.1 HP_HAP_like 48..348 CDD:132717 89/329 (27%)
acp-2NP_495774.1 HP_HAP_like 29..329 CDD:132717 89/323 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164140
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 1 1.000 - - X4294
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.