DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9449 and C27A2.12

DIOPT Version :9

Sequence 1:NP_001137976.1 Gene:CG9449 / 40117 FlyBaseID:FBgn0036875 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001254098.1 Gene:C27A2.12 / 13184830 WormBaseID:WBGene00206373 Length:460 Species:Caenorhabditis elegans


Alignment Length:423 Identity:98/423 - (23%)
Similarity:168/423 - (39%) Gaps:90/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TAKLYDPGADKSTLELLHVVFRHGPRTPADTYPRDPYVNETYY---PFGWGQITNNGKRELFNIG 97
            |.::.:...::..|..:|.|:|||.|:.......|| |:.:.:   ..|:||:|..|..:.|.:|
 Worm    17 TIEINETVPEELQLIFVHTVWRHGDRSQDGHLNNDP-VDPSKWNKGGGGYGQLTPEGMEQQFILG 80

  Fly    98 TWLRKRYGK--FLAPNYSPDSVHAQATGVPRT-HMTMQTVLAAF----------FPPKGTDME-W 148
            ..||.:|.|  ||...|....:..::|.|.|| :..:..:|..|          :|    |:| |
 Worm    81 QKLRDKYVKTGFLQNFYDSQQIFIRSTDVNRTINSAISNMLGMFSSSVSRPGIDYP----DIEGW 141

  Fly   149 NSRFNWQPIPVFSQ-ELNEDTLLLVRKPCPRYFEALNEVYELPEVKAEI--EPYL-------EMF 203
            ...|  .|:|:.|. ...:|.:......|.|..|.|...:|..:.::.:  |.|:       |:|
 Worm   142 PRGF--MPVPIHSAGPAGQDCVASAFCICRRRDELLKIAHEGEQFQSYVQSEKYVNTTLLLSELF 204

  Fly   204 KEL-------EEHTGLSFKE---PEDVQSLYLTLLAEQEWGLELPEWTHAYFPEKLQFLAEQS-- 256
            .:.       :.|..:..::   ||.|        ..|.|      ::..:| |.|..|...|  
 Worm   205 NQTFTWDNMWQVHDAVMIQKIHFPESV--------LNQTW------YSDEFF-ENLDDLERPSKA 254

  Fly   257 YIYNVYTP----------EMQKIKGGPFLKKMLDEMQQK----KNGTLKPS---GRKLFIYAGHD 304
            ::..:|.|          |:.|.:|||.:..:...|:.|    ||.....:   ..|.:.|:.||
 Worm   255 FVTGLYDPPIVQGINVRREILKTRGGPMINDISARMRTKATCAKNEAKCDNYHKNLKYYAYSTHD 319

  Fly   305 STVVNVLSALKIWE--------RQMPRYSSMILFELHKNKETGDYWVEIYFRNDPKGQAQKLT-- 359
            .||..:|:.|.|.:        .:.|.|:|.|..||..||.....:..:.::.:.....:.:|  
 Worm   320 HTVFALLAVLGIEDIVAGPEKYGEWPDYASDIAIELFHNKTDEKPYFRVLYQKNVHSTFETVTSR 384

  Fly   360 LPGC--EFQCPLDKVLEFAKDVVPTEADDKRCE 390
            :.||  |..|.:......||:..|.....:.||
 Worm   385 IKGCRGEQFCDMRTFENKAKESRPDRPIHEFCE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9449NP_001137976.1 HP_HAP_like 48..348 CDD:132717 87/363 (24%)
C27A2.12NP_001254098.1 His_Phos_2 29..370 CDD:278743 87/362 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11567
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.830

Return to query results.
Submit another query.