DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv1 and pkd1l3

DIOPT Version :9

Sequence 1:NP_649116.1 Gene:brv1 / 40116 FlyBaseID:FBgn0036874 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_021333660.1 Gene:pkd1l3 / 565944 ZFINID:ZDB-GENE-060810-132 Length:758 Species:Danio rerio


Alignment Length:584 Identity:104/584 - (17%)
Similarity:183/584 - (31%) Gaps:204/584 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 DAFGLLSVGDVPDIYFFVVSSLV------LAFT----DGKNTSG-----------GAPWI----- 202
            :.|.:.|..::.|....||.:.|      |:||    :|.|.|.           |..|:     
Zfish    71 NGFAVTSTFNITDANVTVVVTAVPNRNISLSFTLHPPNGTNISSWNQSTTVTYKDGYRWLINPDM 135

  Fly   203 --HAEGTRLLGVVRLRQLRTESNRLGLSLPVFTERDFSESWTLPYERVPYTDK-YWPIYTPWLPS 264
              ..:||..:.|  |....|.|:.|...:.||..:..  .|.        ||. .|         
Zfish   136 RKELDGTWKVSV--LPTSYTSSDVLTFKMSVFVTKCL--FWD--------TDNGQW--------- 179

  Fly   265 VSVARDNLLMGIN---HVGHMFNYPESKGYKVLLSDTRHKSLKIIDYLMKKNWLD-ANTTALFMD 325
               :|:..::|.|   ::.|..              ..|.:.....:.:..|.:| :.|.|||..
Zfish   180 ---SREGCMVGPNTMPNLTHCL--------------CNHTTFFGSSFFVMPNQVDLSKTAALFAT 227

  Fly   326 --------------FSLYNADANTFTVCTLWVEKFPYQYPDGHT-RIESHTFVEQLREFTKFGML 375
                          |:||       .:..:|.     .|.|... |....|.:|......::..|
Zfish   228 VNENYIVVVVLSCFFALY-------LILVMWA-----WYADRKALRTRKMTLLEDNHPCAQYNYL 280

  Fly   376 M-----------VFVFVVTWLQFTKAFFLKVWYDPRQL----KTLWVQ--VDAMIVALSLVVGMI 423
            :           ....:...|||.:.     ..|...|    |.::.:  ||..::::...:|.:
Zfish   281 VNVQTGHRRKAGTTAKIKVMLQFAEG-----QSDSYSLSDSEKPVFERGGVDVFLLSMPFSLGEL 340

  Fly   424 MSV---RDN--------LVQKMIKSVEIAVVVDFL--------------DFREPAQLAYLEDVV- 462
            .|:   .||        |.:.||:.::...|..||              :..:..::|...::. 
Zfish   341 QSIDISHDNSGGSPDWYLDKVMIQDLQTQDVSHFLCSTWLRGETCKRTFNSAKKNEIASFGNIFQ 405

  Fly   463 TGLAVALVTMRLWKVLQFSATFQLFTKT--IAMAWDALLCTFVITVIF-----------IIAIGI 514
            |..:.......:|..:........||:.  ::.....||||..|.::|           |:.|  
Zfish   406 TRTSSGFRDEHIWVSIVDPPRRSPFTRVQRVSCCMSLLLCTMAINIMFWNLPTDAESPVILKI-- 468

  Fly   515 ATVTINGNYTSNFRDFPKGIVTVTCFAFGYTNLVYPPDIFYGGEWLGILLYTIMGFVVKYMLINL 579
                  |::...::.|   :|.|....|     ::|         :.||:.||...:...:|:| 
Zfish   469 ------GSFQLTWQQF---MVAVESGLF-----MFP---------INILIITIFRHIKPRILLN- 509

  Fly   580 IVSMMRDQMASVKADRDKKVRQRITF-WQFLRVEYAHFINYIVKVFHCQKGYQRKNRTVAQNIQ 642
                      ..|.|..||.....:. ...:..|....:||:.|        ..||...|:.||
Zfish   510 ----------KGKTDSSKKTTPAASVSMNTIIQETVGLLNYLSK--------SPKNNLPAKEIQ 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv1NP_649116.1 PKD_channel 165..591 CDD:285288 91/529 (17%)
pkd1l3XP_021333660.1 GPS 167..214 CDD:321989 9/82 (11%)
PLAT_polycystin 277..392 CDD:238850 19/119 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276906at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.