DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv1 and F27C1.11

DIOPT Version :9

Sequence 1:NP_649116.1 Gene:brv1 / 40116 FlyBaseID:FBgn0036874 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001362170.1 Gene:F27C1.11 / 3565116 WormBaseID:WBGene00017858 Length:1271 Species:Caenorhabditis elegans


Alignment Length:293 Identity:57/293 - (19%)
Similarity:95/293 - (32%) Gaps:103/293 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 TDGKNTSGGAPWIHAEGTRLLGVVRLRQLRTESNRLGLSLPVFTERDFSESWTLP--YERVPYTD 252
            |..|:|:|.|                |...:||:|....:..:::::    ..||  .|..||.|
 Worm   467 TSRKSTAGSA----------------RSFASESSRAWSRISGYSDKE----QILPSDEEEDPYRD 511

  Fly   253 KYWPIYTPWLPSVSVA-RDNLLMGINHVGHMFNYPESKGYKV------LLSDTRHKSLKIIDY-- 308
                        :..| |:.|......:...:     |||.|      .|.:...|..:|:||  
 Worm   512 ------------IGTAERERLGEAATKIQAAY-----KGYTVRKKHVQFLKEKERKEQEILDYEK 559

  Fly   309 ----------LMKKNWLDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQYPDGHTRIESHTFV 363
                      |..:..||.:|...|:......:....:|....|: ..|....|..:.|.|.|  
 Worm   560 QFIHYTFEVMLGNRFGLDFDTPLFFVLHGENGSSEKIYTQADDWL-FLPSSCYDPESWILSST-- 621

  Fly   364 EQLREFTKFGMLM--------------VFV--FVVT----WLQFTKAFFLKV--WYDPRQLKTLW 406
                ...|.|:|.              .|:  .|:|    ..:..:.|:.:|  |:|..      
 Worm   622 ----RSLKLGVLTSIDVGHEQEGYGAGTFIDKIVITEDEKGAKECRRFYFQVEKWFDSG------ 676

  Fly   407 VQVDAMIVALSLVVGMIMSVRDNLVQKMIKSVE 439
             |||.:||         .:::.|....::.|.|
 Worm   677 -QVDGLIV---------RNIKVNSFLYLVSSTE 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv1NP_649116.1 PKD_channel 165..591 CDD:285288 57/293 (19%)
F27C1.11NP_001362170.1 DCX 26..94 CDD:340456
DUF2967 <89..>407 CDD:371408
PLAT 564..684 CDD:381752 27/142 (19%)
PLAT 713..823 CDD:238061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.