DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv1 and CG42685

DIOPT Version :9

Sequence 1:NP_649116.1 Gene:brv1 / 40116 FlyBaseID:FBgn0036874 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_609717.5 Gene:CG42685 / 34854 FlyBaseID:FBgn0261571 Length:1609 Species:Drosophila melanogaster


Alignment Length:398 Identity:74/398 - (18%)
Similarity:131/398 - (32%) Gaps:152/398 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TGKLFLVYFFMALAF----FDELLYFN-----TEATELLFQCNHGDAFGLLSVGDVPDIYFFVVS 183
            |..:.|:.|| ||.|    |..||:.|     .:..|...||   ||    |||.....:.....
  Fly  1311 TFNMILMIFF-ALLFLLLVFKFLLHLNIISAYLKNPEFRLQC---DA----SVGKSDQSFVSGSE 1367

  Fly   184 SLVLAFTDGKNTSGGAPWIHAEGTRLLGVVRLRQLRTESNRLGLSLPVFTERDFSESWTLPYERV 248
            .|::..|.|:..:|                      |.||                  ...|.:.
  Fly  1368 ILLVIVTGGQEFAG----------------------TTSN------------------VKFYLKS 1392

  Fly   249 PYTDK--YWPIYTPWLPSVSVARDNLLMGINHVGHMF-------------NYPESKGYKVLLSDT 298
            |:..:  |.....|..|  .:.|::.:..:...||::             .||......:.:.|.
  Fly  1393 PHRQQTSYQITQDPGHP--KLLRNSTIKIMVPRGHIYIPTRLALRLVPNGRYPSWYCRSITVVDL 1455

  Fly   299 RHKSLKIIDYLMKKNWLDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQYPDGHTRIESHTFV 363
            :   ||:....:.::|::..:...||. |.|                |.|   ..::|...:|:.
  Fly  1456 K---LKVQQLFLVESWIEGGSHIQFMR-SKY----------------FTY---GNYSRYPKYTWC 1497

  Fly   364 EQLREFTKFGMLMVFVFVVTWLQFTKAFFLKVWY------DPRQLKT------------LWVQVD 410
            ::.|...:            .|.|:       ||      .|.|.|.            :|:...
  Fly  1498 KRFRSRAE------------QLYFS-------WYLINAITGPSQSKVGGIIMNQFERTCVWICKT 1543

  Fly   411 AMIVA-LSLVVG--MIMSVRDNLVQKMIKSVEIAVVVDFLDFREPAQLAYLEDVVTGLAV----- 467
            |:.:| ::|..|  .:.|:::...:.:..|:::.:|| .|.|     .|:|    .|||:     
  Fly  1544 AITLAFVTLYFGKHTVSSIQEETRENVDNSLKVHLVV-MLGF-----FAFL----IGLAIHVLFE 1598

  Fly   468 ALVTMRLW 475
            .::...||
  Fly  1599 VIILRWLW 1606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv1NP_649116.1 PKD_channel 165..591 CDD:285288 59/352 (17%)
CG42685NP_609717.5 REJ 411..753 CDD:307914
PLAT 1367..1480 CDD:238061 23/158 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276906at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.