DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv1 and Pkd1l1

DIOPT Version :9

Sequence 1:NP_649116.1 Gene:brv1 / 40116 FlyBaseID:FBgn0036874 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_038948500.1 Gene:Pkd1l1 / 289796 RGDID:1564724 Length:2586 Species:Rattus norvegicus


Alignment Length:419 Identity:91/419 - (21%)
Similarity:156/419 - (37%) Gaps:103/419 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HQAPETPDENANVDTFMDNLRLRLRTLR--------SELMITERHRNERVNLKYRLITEELWLTG 129
            |.||..|...|        .|.|.|.||        ...::.||.|.||:   .:....::.:..
  Rat  1974 HGAPLPPQVLA--------ARQRERHLRWAQTPSGPKFRVMRERLRRERL---MQAALRDVTMHS 2027

  Fly   130 KLFLVYFFMALAFFDELLYFNTEATELLFQCNHGDAFGLLSVGDVPDIYFFVVSSLVLAFTDGKN 194
            .:.|:..|:|...|....|...:|....|..|...:.|.||  ...|.:.:.:|:|:    ||.:
  Rat  2028 VMLLLLLFIAYGRFCPGEYSLNQAIRRAFTRNAHHSLGDLS--STEDWWDWTLSTLL----DGLH 2086

  Fly   195 TS-------GGAPWIHAEGTRLLGVVRLRQLRTESNRLGLSLPVFTERDFSESWTLPYERVPYTD 252
            ..       |..|........|:|...::||:..:....::...|:|               ..:
  Rat  2087 PERMPATAWGSQPGALGGQCHLIGPSVIKQLKVSAGTACVAPKPFSE---------------LVE 2136

  Fly   253 KYWPIYTPW--LPSVSVARDNLLMGINHVGHMFNYPESKG-----YKVLLSDTRHKSLKIIDYLM 310
            ...|:::..  |.:.:|..|:              |::.|     |...|..|||::...:..|.
  Rat  2137 DVLPMHSHALDLENRNVTPDD--------------PKTCGVKKESYTHSLGRTRHEAHAALTALR 2187

  Fly   311 KKNWLDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQYPDGHTR-IESHTFVEQLREFTKFG- 373
            ...|:|.:|.|:.:.|:|||.....||..||..|..       .|| :.|.:.:|....|.:.. 
  Rat  2188 ASRWIDHSTRAVSVHFTLYNPPTRLFTSVTLGAEFL-------STRGLVSSSLIESFSIFYRDSA 2245

  Fly   374 -----MLMVFVFVV---------TWLQFTKAFFLKVWYDPRQLKTLWVQVDAMIVALSLVV--GM 422
                 ||...:|:|         .|...||. .|..|..|||    |:::..:.|||:...  |.
  Rat  2246 LQCLLMLSELLFLVLNMIHLCFQLWEMATKG-ILSYWRKPRQ----WLELSMVGVALAYCAASGH 2305

  Fly   423 IMSVRDNLVQKMIKS-----VEIAVVVDF 446
            :.::.:|:..:..|.     |:|:::|.:
  Rat  2306 LTTLAENITDQFHKGLYQRFVDISLMVSW 2334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv1NP_649116.1 PKD_channel 165..591 CDD:285288 68/319 (21%)
Pkd1l1XP_038948500.1 PCC <242..725 CDD:188093
GPS 1398..1436 CDD:413374
PLAT_polycystin 1504..1622 CDD:238850
PKD_channel 2063..2389 CDD:400395 68/319 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276906at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.