DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv1 and CG30048

DIOPT Version :9

Sequence 1:NP_649116.1 Gene:brv1 / 40116 FlyBaseID:FBgn0036874 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001014521.2 Gene:CG30048 / 246415 FlyBaseID:FBgn0050048 Length:1125 Species:Drosophila melanogaster


Alignment Length:327 Identity:64/327 - (19%)
Similarity:103/327 - (31%) Gaps:118/327 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NLRLRLRTLRSELMITERHRNERVNLKYRLIT----------EELWLTGKLFLVYFFMALAFFDE 145
            ||.|   ||...|...::.:...:....::|.          ||.:|..|.           ||.
  Fly   381 NLTL---TLAHRLYFVDQQKESLLTKMVKIINNNFERIKRNEEETFLMEKP-----------FDN 431

  Fly   146 LLYFNTEATELLFQ-CNHGDAFGLLSVGDVPDIYFFVVSSLVLAFTDG----------------- 192
            |.....|..|::.: |.           |.|.....|......||:.|                 
  Fly   432 LRLACREVYEIIKRLCK-----------DTPSPPMSVYDQYYRAFSTGKLDQSFVEKLVDETQKL 485

  Fly   193 ---KNTSGGAPWIHA--EGTRLL-------GVVR---LRQLRTESNRLGLSLPVFTERDFSESWT 242
               |:||....|:::  |..||.       |:.|   :...:..||.:.|.:..|.        |
  Fly   486 AKDKSTSSWVMWLNSTWEMERLYRHLNYDRGLYRSDIIDPRKEMSNGVALEVQCFD--------T 542

  Fly   243 LPYE--RVPYTDKYWPIYTPWLPSVSVARDNLLMGINHVGHMFNYPESKGYKVLLSDTRHKSLKI 305
            .|.:  ||..:|:.                          ||..:..:...:||.:|.....||:
  Fly   543 FPKKIVRVLSSDRI--------------------------HMVLFARAVLNEVLKTDEGRVCLKL 581

  Fly   306 IDYLMKKNW---LDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQYPDGHTRIESHTFVEQLR 367
            :...:|.||   ::...:.|.:...:|..:.| |||          |.|...::|...||:....
  Fly   582 VSMKLKLNWWYPINKKPSTLVLSVRIYQREDN-FTV----------QIPLNRSQIHMKTFITYDP 635

  Fly   368 EF 369
            ||
  Fly   636 EF 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv1NP_649116.1 PKD_channel 165..591 CDD:285288 47/242 (19%)
CG30048NP_001014521.2 REJ 42..346 CDD:280229
PLAT 896..996 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276906at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.