Sequence 1: | NP_649115.2 | Gene: | CG18294 / 40115 | FlyBaseID: | FBgn0036873 | Length: | 141 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_652417.2 | Gene: | CG13066 / 50270 | FlyBaseID: | FBgn0040797 | Length: | 93 | Species: | Drosophila melanogaster |
Alignment Length: | 136 | Identity: | 48/136 - (35%) |
---|---|---|---|
Similarity: | 60/136 - (44%) | Gaps: | 50/136 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 AVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGI 69
Fly 70 AAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAPLAHISSLAYTSPLAYSAL 134
Fly 135 PSAPVL 140 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |