DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18294 and CG14096

DIOPT Version :10

Sequence 1:NP_649115.2 Gene:CG18294 / 40115 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster


Alignment Length:142 Identity:109/142 - (76%)
Similarity:113/142 - (79%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65

  Fly    66 YNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAPLAHISSLAYTSPLA 130
            |||||.|||||||||||||||.|||.|                    .|:|||:.:.||||||||
  Fly    66 YNGIAVAPVIAPVAAPVVAKYTAAPFA--------------------YASPLAYSAPLAYTSPLA 110

  Fly   131 YSALP-SAPVLL 141
            |..|| :|||||
  Fly   111 YKTLPAAAPVLL 122

Return to query results.
Submit another query.