DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18294 and CG14095

DIOPT Version :9

Sequence 1:NP_649115.2 Gene:CG18294 / 40115 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_649112.1 Gene:CG14095 / 40112 FlyBaseID:FBgn0036870 Length:162 Species:Drosophila melanogaster


Alignment Length:174 Identity:87/174 - (50%)
Similarity:100/174 - (57%) Gaps:47/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||.||||.|::||.|||||||..|||             :.||.|:|||||||||.||||:||.
  Fly     1 MFKYAVVICALIACVAAKPGLLHTPLA-------------ALPAPVIAAPAPVVTAASSQVVART 52

  Fly    66 YNGIAAAPVIA--PVAAPVVAKYAAAPLAAPVVAKYA---------------AAPLAAPV---VA 110
            :||||||||||  |||...|.:..|||||||:.|..|               |||||||:   ||
  Fly    53 FNGIAAAPVIAQVPVAPAPVLRTVAAPLAAPLAAPLAAPLRAPAPVAFAAPVAAPLAAPILNRVA 117

  Fly   111 KYA-------AAPLAH---ISSLA-YTSPLAYSALP---SAPVL 140
            .:|       |||.||   ...|| |.:||||:..|   :||.|
  Fly   118 PFAAPIATPFAAPYAHPYAAPVLAKYAAPLAYAPAPLNYAAPAL 161



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448867
Domainoid 1 1.000 79 1.000 Domainoid score I15489
eggNOG 1 0.900 - - E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I7469
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.