Sequence 1: | NP_649115.2 | Gene: | CG18294 / 40115 | FlyBaseID: | FBgn0036873 | Length: | 141 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648193.1 | Gene: | CG13678 / 38922 | FlyBaseID: | FBgn0035859 | Length: | 128 | Species: | Drosophila melanogaster |
Alignment Length: | 154 | Identity: | 68/154 - (44%) |
---|---|---|---|
Similarity: | 84/154 - (54%) | Gaps: | 41/154 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP--APVVTATSSQVIA 63
Fly 64 RNYNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAA--APLAAPVVAKYAAAPLAHISSLAYT 126
Fly 127 SPLAYS---------ALPSAPVLL 141 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |