Sequence 1: | NP_649115.2 | Gene: | CG18294 / 40115 | FlyBaseID: | FBgn0036873 | Length: | 141 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_729345.1 | Gene: | CG13679 / 38919 | FlyBaseID: | FBgn0035856 | Length: | 119 | Species: | Drosophila melanogaster |
Alignment Length: | 143 | Identity: | 65/143 - (45%) |
---|---|---|---|
Similarity: | 80/143 - (55%) | Gaps: | 36/143 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 AVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP--APVVTATSSQVIARNYN 67
Fly 68 GIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAPLAHISSLAYTSPLAYS 132
Fly 133 ----ALPSAPVLL 141 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |