DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18294 and CG13679

DIOPT Version :9

Sequence 1:NP_649115.2 Gene:CG18294 / 40115 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_729345.1 Gene:CG13679 / 38919 FlyBaseID:FBgn0035856 Length:119 Species:Drosophila melanogaster


Alignment Length:143 Identity:65/143 - (45%)
Similarity:80/143 - (55%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP--APVVTATSSQVIARNYN 67
            ||...|:||.|||||||:       |||| :|||||:|||.|.:|.  ||..::.|:..:|.:  
  Fly     5 AVCFFAVVAVAAAKPGLV-------APLA-AAPLAYTAPAVVGSAAYVAPYASSYSAHSVAHS-- 59

  Fly    68 GIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAPLAHISSLAYTSPLAYS 132
              ||.|          |.|.|| ..|||.|.|     .|||.|.| |||:|..:: |||||||||
  Fly    60 --AAFP----------AAYTAA-YTAPVAAAY-----TAPVAAAY-AAPIAPYAA-AYTSPLAYS 104

  Fly   133 ----ALPSAPVLL 141
                |..:||:||
  Fly   105 SPYVATAAAPLLL 117



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.