DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18294 and CG32212

DIOPT Version :9

Sequence 1:NP_649115.2 Gene:CG18294 / 40115 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_730416.1 Gene:CG32212 / 317917 FlyBaseID:FBgn0052212 Length:111 Species:Drosophila melanogaster


Alignment Length:115 Identity:76/115 - (66%)
Similarity:81/115 - (70%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||.||::|..||||||||.||||.||||.||||||||.|||.||||.||.|.|||||   ||||
  Fly     1 MFKYAVLVLITVACAAAKPDLLGAALAYTGPLAYSAPLDYSALAAVVTAPTPPVTATS---IARN 62

  Fly    66 YNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAA 115
            .|||.||..||.||||||||||||.||.|     :....:||:....|||
  Fly    63 NNGIDAASEIASVAAPVVAKYAAASLAYP-----SRLANSAPISCASAAA 107



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I15489
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I7469
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.