DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12519 and CG13051

DIOPT Version :10

Sequence 1:NP_649114.2 Gene:CG12519 / 40114 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001097618.1 Gene:CG13051 / 5740583 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster


Alignment Length:136 Identity:48/136 - (35%)
Similarity:60/136 - (44%) Gaps:60/136 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIAR 64
            ||| .|.||.|:.||.|||||::       ||||||||.                          
  Fly     1 MFKFVAAVIFALFACVAAKPGIV-------APLAYSAPY-------------------------- 32

  Fly    65 NYNGIAAAPVIAPVAAPVVAK-YAAAP-LAAPVVAKYAATPLAAPLAYSSP--LAYSAPLSYAVP 125
                         ||:|.||. |.|:| :|||..|.|.|       ||::|  .||:||  ||..
  Fly    33 -------------VASPYVASPYVASPYVAAPYTAAYTA-------AYAAPYTTAYTAP--YAAY 75

  Fly   126 SAPLLI 131
            ::|||:
  Fly    76 TSPLLL 81

Return to query results.
Submit another query.