| Sequence 1: | NP_001262046.1 | Gene: | CG12519 / 40114 | FlyBaseID: | FBgn0036872 | Length: | 131 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097618.1 | Gene: | CG13051 / 5740583 | FlyBaseID: | FBgn0040799 | Length: | 83 | Species: | Drosophila melanogaster |
| Alignment Length: | 136 | Identity: | 48/136 - (35%) |
|---|---|---|---|
| Similarity: | 60/136 - (44%) | Gaps: | 60/136 - (44%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIAR 64
Fly 65 NYNGIAAAPVIAPVAAPVVAK-YAAAP-LAAPVVAKYAATPLAAPLAYSSP--LAYSAPLSYAVP 125
Fly 126 SAPLLI 131 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR35685 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||