DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12519 and CG14096

DIOPT Version :9

Sequence 1:NP_001262046.1 Gene:CG12519 / 40114 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster


Alignment Length:133 Identity:106/133 - (79%)
Similarity:115/133 - (86%) Gaps:13/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65

  Fly    66 YNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAATPLAAPLAYSSPLAYSAPLSY-AVP-SAP 128
            |||||.|||||||||||||||.|||.|           .|:|||||:||||::||:| .:| :||
  Fly    66 YNGIAVAPVIAPVAAPVVAKYTAAPFA-----------YASPLAYSAPLAYTSPLAYKTLPAAAP 119

  Fly   129 LLI 131
            :|:
  Fly   120 VLL 122



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I15489
eggNOG 1 0.900 - - E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I7469
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25850
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.