| Sequence 1: | NP_001262046.1 | Gene: | CG12519 / 40114 | FlyBaseID: | FBgn0036872 | Length: | 131 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649112.1 | Gene: | CG14095 / 40112 | FlyBaseID: | FBgn0036870 | Length: | 162 | Species: | Drosophila melanogaster |
| Alignment Length: | 173 | Identity: | 82/173 - (47%) |
|---|---|---|---|
| Similarity: | 97/173 - (56%) | Gaps: | 60/173 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
Fly 66 YNGIAAAPVI---------------APVAAPVVAKYA---------------AAPLAAPV---VA 97
Fly 98 KYA---ATPLAAPLA----------YSSPLAYS-APLSYAVPS 126 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 79 | 1.000 | Domainoid score | I15489 |
| eggNOG | 1 | 0.900 | - | - | E1_2BWJG | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I7469 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0005927 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR35685 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 5.960 | |||||