DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12519 and CG13067

DIOPT Version :9

Sequence 1:NP_001262046.1 Gene:CG12519 / 40114 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_648857.1 Gene:CG13067 / 39785 FlyBaseID:FBgn0036589 Length:79 Species:Drosophila melanogaster


Alignment Length:109 Identity:40/109 - (36%)
Similarity:50/109 - (45%) Gaps:36/109 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAP--AAVVAAPAPVVTATSSQVI 62
            ||| .|:.:.|||||.:|||.:|.:||||:   |||||...:||  ||..||             
  Fly     1 MFKYFALCLFAIVACVSAKPAVLASPLAYS---AYSAPYVAAAPYSAAYTAA------------- 49

  Fly    63 ARNYNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAATPLAA 106
                           ..|||.|.|:|  ...|..:.|:|.|.||
  Fly    50 ---------------YTAPVAAAYSA--YTYPYASAYSAYPYAA 76



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.