DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12519 and CG32212

DIOPT Version :9

Sequence 1:NP_001262046.1 Gene:CG12519 / 40114 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_730416.1 Gene:CG32212 / 317917 FlyBaseID:FBgn0052212 Length:111 Species:Drosophila melanogaster


Alignment Length:131 Identity:81/131 - (61%)
Similarity:87/131 - (66%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||.||::|..||||||||.||||.||||.||||||||.|||.||||.||.|.|||||   ||||
  Fly     1 MFKYAVLVLITVACAAAKPDLLGAALAYTGPLAYSAPLDYSALAAVVTAPTPPVTATS---IARN 62

  Fly    66 YNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAATPLAAPLAYSSPLAYSAPLSYAVPSAPLL 130
            .|||.||..||.||||||||||                 ||.|||.|.||.|||:|.|..:|.::
  Fly    63 NNGIDAASEIASVAAPVVAKYA-----------------AASLAYPSRLANSAPISCASAAAQVI 110

  Fly   131 I 131
            |
  Fly   111 I 111



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455766
Domainoid 1 1.000 79 1.000 Domainoid score I15489
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I7469
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.