DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14096 and CG13051

DIOPT Version :10

Sequence 1:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001097618.1 Gene:CG13051 / 5740583 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster


Alignment Length:116 Identity:51/116 - (43%)
Similarity:59/116 - (50%) Gaps:38/116 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIAR 64
            ||| .|.||.|:.||.|||||::             ||||||||  .||:|     ..:|..:|.
  Fly     1 MFKFVAAVIFALFACVAAKPGIV-------------APLAYSAP--YVASP-----YVASPYVAS 45

  Fly    65 NYNGIAVAPVIAPVAAPVVAKYTAAPFAYASP--LAYSAP-LAYTSPLAYK 112
            .|           ||||..|.|||   |||:|  .||:|| .||||||..|
  Fly    46 PY-----------VAAPYTAAYTA---AYAAPYTTAYTAPYAAYTSPLLLK 82

Return to query results.
Submit another query.