DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14096 and LOC5667237

DIOPT Version :10

Sequence 1:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_001688040.2 Gene:LOC5667237 / 5667237 VectorBaseID:AGAMI1_000684 Length:142 Species:Anopheles gambiae


Alignment Length:117 Identity:42/117 - (35%)
Similarity:54/117 - (46%) Gaps:29/117 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNG 68
            |.|.:.:::|.|:|||.:|             .|:          .|. ||||.||||.||.|||
Mosquito     6 SIVAVCSLLAVASAKPHVL-------------TPV----------GPG-VVTAQSSQVFARTYNG 46

  Fly    69 IAVAPVIAPVAAPVVAKYTAAPFAYASPLAYSAPLAYTSPLAYKTLPAAAPV 120
            .....|.||:.|||    .|..:.:..|.|..||:.|..|:.|.. |||.||
Mosquito    47 FVPFAVPAPIPAPV----PAPAYHFVLPAAPPAPVFYPQPVVYNP-PAAIPV 93

Return to query results.
Submit another query.