Sequence 1: | NP_649113.1 | Gene: | CG14096 / 40113 | FlyBaseID: | FBgn0036871 | Length: | 122 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649115.2 | Gene: | CG18294 / 40115 | FlyBaseID: | FBgn0036873 | Length: | 141 | Species: | Drosophila melanogaster |
Alignment Length: | 142 | Identity: | 109/142 - (76%) |
---|---|---|---|
Similarity: | 113/142 - (79%) | Gaps: | 21/142 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
Fly 66 YNGIAVAPVIAPVAAPVVAKYTAAPFA--------------------YASPLAYSAPLAYTSPLA 110
Fly 111 YKTLPAAAPVLL 122 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45448857 | |
Domainoid | 1 | 1.000 | 79 | 1.000 | Domainoid score | I15489 |
eggNOG | 1 | 0.900 | - | - | E1_2BWJG | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I7469 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005927 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.890 |