DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14096 and CG12519

DIOPT Version :10

Sequence 1:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_649114.2 Gene:CG12519 / 40114 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster


Alignment Length:133 Identity:106/133 - (79%)
Similarity:115/133 - (86%) Gaps:13/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65

  Fly    66 YNGIAVAPVIAPVAAPVVAKYTAAPFA-----------YASPLAYSAPLAYTSPLAYKTLPAAAP 119
            |||||.|||||||||||||||.|||.|           .|:|||||:||||::||:| .:| :||
  Fly    66 YNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAATPLAAPLAYSSPLAYSAPLSY-AVP-SAP 128

  Fly   120 VLL 122
            :|:
  Fly   129 LLI 131

Return to query results.
Submit another query.