Sequence 1: | NP_649113.1 | Gene: | CG14096 / 40113 | FlyBaseID: | FBgn0036871 | Length: | 122 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648193.1 | Gene: | CG13678 / 38922 | FlyBaseID: | FBgn0035859 | Length: | 128 | Species: | Drosophila melanogaster |
Alignment Length: | 131 | Identity: | 64/131 - (48%) |
---|---|---|---|
Similarity: | 77/131 - (58%) | Gaps: | 14/131 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATS---SQVI 62
Fly 63 ARNYNGIAVAPVIAPVAAPVVAKYTAAPFAYASP--LAYSAPLAYTSPLAYKTLP----AAAPVL 121
Fly 122 L 122 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |