DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14096 and CG32214

DIOPT Version :10

Sequence 1:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_730409.2 Gene:CG32214 / 317919 FlyBaseID:FBgn0052214 Length:116 Species:Drosophila melanogaster


Alignment Length:126 Identity:94/126 - (74%)
Similarity:104/126 - (82%) Gaps:14/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||.|||:||:||||||||||||||||||      ||||||||||||||||||||||||||||||
  Fly     1 MFKYAVVVLALVACAAAKPGLLGAPLAYT------APLAYSAPAAVVAAPAPVVTATSSQVIARN 59

  Fly    66 YNGIAVAPVIAPV----AAPVVAKYTAAPFAYASPLAYSAPLAYTSPLAYKTLPAAAPVLL 122
            |||||.|||||||    ||||||||.|.|.  |:|||||:||||::||:|..  |:.|:|:
  Fly    60 YNGIAAAPVIAPVAAPLAAPVVAKYAATPL--AAPLAYSSPLAYSAPLSYAA--ASGPLLI 116

Return to query results.
Submit another query.