DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14096 and 825-Oak

DIOPT Version :9

Sequence 1:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_730410.2 Gene:825-Oak / 317916 FlyBaseID:FBgn0052208 Length:129 Species:Drosophila melanogaster


Alignment Length:137 Identity:95/137 - (69%)
Similarity:103/137 - (75%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||.|||:||:||||||||||||||||||      ||||||||||||||||||||||||||||||
  Fly     1 MFKYAVVVLALVACAAAKPGLLGAPLAYT------APLAYSAPAAVVAAPAPVVTATSSQVIARN 59

  Fly    66 YNGIAVAPVIAPV----AAPVVAKYTAAPFA-----------YASPLAYSAPLAYTSPLAYKTLP 115
            |||||.|||||||    ||||||||.|.|.|           .|:.||||:||||::||:|...|
  Fly    60 YNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVVAKYAATPLAARLAYSSPLAYSAPLSYAAAP 124

  Fly   116 AAAPVLL 122
              ||.|:
  Fly   125 --APFLI 129



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448860
Domainoid 1 1.000 79 1.000 Domainoid score I15489
eggNOG 1 0.900 - - E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I7469
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.