Sequence 1: | NP_649113.1 | Gene: | CG14096 / 40113 | FlyBaseID: | FBgn0036871 | Length: | 122 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_730410.2 | Gene: | 825-Oak / 317916 | FlyBaseID: | FBgn0052208 | Length: | 129 | Species: | Drosophila melanogaster |
Alignment Length: | 137 | Identity: | 95/137 - (69%) |
---|---|---|---|
Similarity: | 103/137 - (75%) | Gaps: | 23/137 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
Fly 66 YNGIAVAPVIAPV----AAPVVAKYTAAPFA-----------YASPLAYSAPLAYTSPLAYKTLP 115
Fly 116 AAAPVLL 122 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45448860 | |
Domainoid | 1 | 1.000 | 79 | 1.000 | Domainoid score | I15489 |
eggNOG | 1 | 0.900 | - | - | E1_2BWJG | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I7469 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005927 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.890 |